PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010105426.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 422aa    MW: 47650.4 Da    PI: 6.9715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010105426.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-3190143255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m++kgL+++hvkSHLQ+YR+
  XP_010105426.1  90 PRLRWTPDLHLCFVRAVERLGGQERATPKLVLQMMNIKGLSIAHVKSHLQMYRS 143
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.14286146IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2986144IPR009057Homeodomain-like
SuperFamilySSF466891.02E-1487144IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2290145IPR006447Myb domain, plants
PfamPF002491.7E-991142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MEKSIDSGSK VISKTSPSNN YNINNEYQDD EENEEEEEEE DQEKADDSGQ QNINGRSSSN  60
STVEENNNGS SKKGSASGGS VRQYIRSKTP RLRWTPDLHL CFVRAVERLG GQERATPKLV  120
LQMMNIKGLS IAHVKSHLQM YRSKKIEDPN QDPHSFKTVL SEQGFFLEGG DHQIYNLSQL  180
PMLQGFNQWP TSSGLIRYAD SSWRSSTRDH QIYSPQYSSF RTAFDSAKNG VYGSVAERLF  240
RNNNNSINIG SATSTLDTSA SWRSRHQTHD QGESFRRSWR TQIFNNPSST ELDLSLQNKR  300
IMLHEKGFMR DHQVVNTITT YNLSTSSTNS RSVQEGGQNK LKRKVLDSER DSDLDLNLSL  360
KIRPKDDHDH EEVDINSTSL CLSLSPSSSS NKLIMSRLKE EAGGLIQDRK LGRTASTLDL  420
TL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105426.10.0Putative Myb family transcription factor
TrEMBLW9SFW50.0W9SFW5_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.18e-49G2-like family protein